SCOP 1.61: Domain d1mcww2: 1mcw W:112-216

Lineage for d1mcww2 (1mcw W:112-216)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Immunoglobulin (constant domains of L and H chains) [48972] (180 species)

7. Species Heterologous L chain dimer MCG-WEIR hybrid (human) [49118] (1 PDB entry)

8. Domain d1mcww2: 1mcw W:112-216 [21509]
   Other proteins in same PDB: d1mcwm1, d1mcww1

Details for d1mcww2

PDB Entry: 1mcw, 3.5 Å

PDB Description: three-dimensional structure of a hybrid light chain dimer. protein engineering of a binding cavity

SCOP Domain Sequences for d1mcww2:

Sequence; same for both SEQRES and ATOM records:

>d1mcww2 b.1.1.2 (W:112-216) Immunoglobulin (constant domains of L and H chains) {Heterologous L chain dimer MCG-WEIR hybrid (human)}
qpkanptvtlfppsseelqankatlvclisdfypgavtvawkadgspveagvettkpskq
snnkyaassylsltpeqwkshrsyscqvthegstvektvaptecs

Timeline for d1mcww2:

• d1mcww2 first appeared (with stable ids) in SCOP 1.55
  
• d1mcww2 appears in SCOP 1.59
  
• d1mcww2 appears in SCOP 1.63
  
• d1mcww2 appears in the current release, SCOPe 2.08