Class b: All beta proteins [48724] (111 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (6 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
Protein Immunoglobulin (constant domains of L and H chains) [48972] (180 species) |
Species Heterologous L chain dimer MCG-WEIR hybrid (human) [49118] (1 PDB entry) |
Domain d1mcww2: 1mcw W:112-216 [21509] Other proteins in same PDB: d1mcwm1, d1mcww1 |
PDB Entry: 1mcw (more details), 3.5 Å
SCOP Domain Sequences for d1mcww2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mcww2 b.1.1.2 (W:112-216) Immunoglobulin (constant domains of L and H chains) {Heterologous L chain dimer MCG-WEIR hybrid (human)} qpkanptvtlfppsseelqankatlvclisdfypgavtvawkadgspveagvettkpskq snnkyaassylsltpeqwkshrsyscqvthegstvektvaptecs
Timeline for d1mcww2: