SCOP 1.55: Domain d1mcwm2: 1mcw M:112-216

Lineage for d1mcwm2 (1mcw M:112-216)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Immunoglobulin (constant domains of L and H chains) [48972] (152 species)

7. Species Heterologous L chain dimer MCG-WEIR hybrid (human) [49118] (1 PDB entry)

8. Domain d1mcwm2: 1mcw M:112-216 [21508]
   Other proteins in same PDB: d1mcwm1, d1mcww1

Details for d1mcwm2

PDB Entry: 1mcw, 3.5 Å

PDB Description: three-dimensional structure of a hybrid light chain dimer. protein engineering of a binding cavity

SCOP Domain Sequences for d1mcwm2:

Sequence; same for both SEQRES and ATOM records:

>d1mcwm2 b.1.1.2 (M:112-216) Immunoglobulin (constant domains of L and H chains) {Heterologous L chain dimer MCG-WEIR hybrid (human)}
qpkanptvtlfppsseelqankatlvclisdfypgavtvawkadgspvkagvettkpskq
snnkyaassylsltpeqwkshrsyscqvthegstvektvaptecs

Timeline for d1mcwm2:

• d1mcwm2 appears in SCOP 1.57
  
• d1mcwm2 appears in the current release, SCOPe 2.08