SCOPe 2.04: Domain d3q5yc2: 3q5y C:118-247

Lineage for d3q5yc2 (3q5y C:118-247)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (9 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224855] (343 PDB entries)

8. Domain d3q5yc2: 3q5y C:118-247 [215075]
   Other proteins in same PDB: d3q5ya1, d3q5yb1, d3q5yc1, d3q5yd1
   automated match to d1lp9f2
   complexed with epe, gol, peg

Details for d3q5yc2

PDB Entry: 3q5y, 1.9 Å

PDB Description: V beta/V beta homodimerization-based pre-TCR model suggested by TCR beta crystal structures

PDB Compounds: (C:) TCR N15 beta

SCOPe Domain Sequences for d3q5yc2:

Sequence; same for both SEQRES and ATOM records:

>d3q5yc2 b.1.1.2 (C:118-247) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dlrnvtppkvslfepskaeiankqkatlvclargffpdhvelswwvngkevhsgvstdpq
aykesnysyslssrlrvsatfwhnprnhfrcqvqfhglseedkwpegspkpvtqnisaea
wgrads

Timeline for d3q5yc2:

• d3q5yc2 first appeared in SCOPe 2.03
  
• d3q5yc2 appears in SCOPe 2.05
  
• d3q5yc2 appears in the current release, SCOPe 2.08