Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (19 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [188198] (388 PDB entries) |
Domain d3q5ya1: 3q5y A:0-117 [215070] Other proteins in same PDB: d3q5ya2, d3q5yb2, d3q5yc2, d3q5yd2 automated match to d1lp9f1 complexed with epe, gol, peg |
PDB Entry: 3q5y (more details), 1.9 Å
SCOPe Domain Sequences for d3q5ya1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3q5ya1 b.1.1.0 (A:0-117) automated matches {Mouse (Mus musculus) [TaxId: 10090]} mdsgvvqsprhiikekggrsvltcipisghsnvvwyqqtlgkelkfliqhyekverdkgf lpsrfsvqqfddyhsemnmsaleledsamyfcasslrwgdeqyfgpgtrltvle
Timeline for d3q5ya1: