SCOPe 2.05: Domain d3q5ta1: 3q5t A:3-115

Lineage for d3q5ta1 (3q5t A:3-115)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (26 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (413 PDB entries)

8. Domain d3q5ta1: 3q5t A:3-115 [215068]
   Other proteins in same PDB: d3q5ta2
   automated match to d1lp9f1

Details for d3q5ta1

PDB Entry: 3q5t, 2 Å

PDB Description: v beta/v beta homodimerization-based pre-tcr model suggested by tcr beta crystal structures

PDB Compounds: (A:) TCR N30 beta

SCOPe Domain Sequences for d3q5ta1:

Sequence; same for both SEQRES and ATOM records:

>d3q5ta1 b.1.1.0 (A:3-115) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
agvtqspryavlqegqsvsfwcdpisghdtlywyqqprdqgpqllvyfrdeavidnsqlp
sdrfsavrpkgtnstlkiqsakqgdtatylcasssgvgtevffgkgtrltvve

Timeline for d3q5ta1:

• d3q5ta1 first appeared in SCOPe 2.03
  
• d3q5ta1 appears in SCOPe 2.04
  
• d3q5ta1 appears in SCOPe 2.06
  
• d3q5ta1 appears in the current release, SCOPe 2.08