SCOPe 2.08: Domain d3q5ld1: 3q5l D:1-208

Lineage for d3q5ld1 (3q5l D:1-208)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
   8-stranded mixed beta-sheet; 2 layers: alpha/beta

4. Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families)

5. Family d.122.1.1: Heat shock protein 90, HSP90, N-terminal domain [55875] (2 proteins)

6. Protein automated matches [190229] (13 species)
   not a true protein

7. Species Leishmania major [TaxId:347515] [195250] (5 PDB entries)

8. Domain d3q5ld1: 3q5l D:1-208 [215067]
   Other proteins in same PDB: d3q5la2, d3q5lb2, d3q5lc2, d3q5ld2
   automated match to d3u67a_
   complexed with kx2

Details for d3q5ld1

PDB Entry: 3q5l, 2.65 Å

PDB Description: crystal structure of the amino-terminal domain of hsp90 from leishmania major, lmjf33.0312:m1-k 213 in the presence of 17-aep- geldanamycin

PDB Compounds: (D:) Heat shock protein 83-1

SCOPe Domain Sequences for d3q5ld1:

Sequence; same for both SEQRES and ATOM records:

>d3q5ld1 d.122.1.1 (D:1-208) automated matches {Leishmania major [TaxId: 347515]}
mtetfafqaeinqlmsliintfysnkeiflrelisnasdacdkiryqsltdpsvlgespr
lcirvvpdkenktltvedngigmtkadlvnnlgtiarsgtkafmealeaggdmsmigqfg
vgfysaylvadrvtvtsknnsdesyvwessaggtftitstpesdmkrgtritlhlkedqm
eyleprrlkelikkhsefigydielmve

Timeline for d3q5ld1:

• d3q5ld1 first appeared in SCOPe 2.03, called d3q5ld_
  
• d3q5ld1 appears in SCOPe 2.07