SCOP 1.57: Domain d1a8jh2: 1a8j H:112-216

Lineage for d1a8jh2 (1a8j H:112-216)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Immunoglobulin (constant domains of L and H chains) [48972] (161 species)

7. Species Lambda L chain dimer MCG (human) [49117] (18 PDB entries)

8. Domain d1a8jh2: 1a8j H:112-216 [21505]
   Other proteins in same PDB: d1a8jh1, d1a8jl1

Details for d1a8jh2

PDB Entry: 1a8j, 2.7 Å

PDB Description: immunoglobulin lambda light chain dimer (mcg) complex with aspartame

SCOP Domain Sequences for d1a8jh2:

Sequence; same for both SEQRES and ATOM records:

>d1a8jh2 b.1.1.2 (H:112-216) Immunoglobulin (constant domains of L and H chains) {Lambda L chain dimer MCG (human)}
qpkanptvtlfppsseelqankatlvclisdfypgavtvawkadgspvkagvettkpskq
snnkyaassylsltpeqwkshrsyscqvthegstvektvaptecs

Timeline for d1a8jh2:

• d1a8jh2 first appeared (with stable ids) in SCOP 1.55
  
• d1a8jh2 appears in SCOP 1.59
  
• d1a8jh2 appears in the current release, SCOPe 2.08