Class b: All beta proteins [48724] (180 folds) |
Fold b.74: Carbonic anhydrase [51068] (1 superfamily) single sheet; 10 strands |
Superfamily b.74.1: Carbonic anhydrase [51069] (2 families) |
Family b.74.1.0: automated matches [191576] (1 protein) not a true family |
Protein automated matches [191011] (16 species) not a true protein |
Species Fungus (Aspergillus oryzae) [TaxId:5062] [226089] (1 PDB entry) |
Domain d3q31a_: 3q31 A: [215049] automated match to d3f7ba_ complexed with mlt, nag, zn |
PDB Entry: 3q31 (more details), 2.7 Å
SCOPe Domain Sequences for d3q31a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3q31a_ b.74.1.0 (A:) automated matches {Fungus (Aspergillus oryzae) [TaxId: 5062]} nkfnytglggplnwygldeaneacakgkhqspividsaaidyaasgslkldlpladgskl enlgfglqvtltngsltansktytlaqfhfhtpsehhvneehfpmevhfvfqtaaketav vgfffqlsevgdsvplfdsvfapidnipdagtstttgqldfgglldhfnrhgvyqytgsl ttppcteevmwnlsteplpltvqgynkvkkiikynarytqnalgqdnllevaaqkl
Timeline for d3q31a_: