Lineage for d3q0ta1 (3q0t A:40-508)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2076457Fold b.70: 8-bladed beta-propeller [50997] (3 superfamilies)
    consists of eight 4-stranded beta-sheet motifs; meander
    also found in some members of the WD40-repeat superfamily
  4. 2076570Superfamily b.70.3: DPP6 N-terminal domain-like [82171] (1 family) (S)
    automatically mapped to Pfam PF00930
  5. 2076571Family b.70.3.1: DPP6 N-terminal domain-like [82172] (3 proteins)
    Pfam PF00930
  6. 2076578Protein Dipeptidyl peptidase IV/CD26, N-terminal domain [82173] (2 species)
  7. 2076579Species Human (Homo sapiens) [TaxId:9606] [82174] (93 PDB entries)
    Uniprot P27487 39-776 ! Uniprot P27487 ! Uniprot P27487
  8. 2076680Domain d3q0ta1: 3q0t A:40-508 [215013]
    Other proteins in same PDB: d3q0ta2, d3q0tb2
    automated match to d1orva1
    complexed with lge, nag

Details for d3q0ta1

PDB Entry: 3q0t (more details), 2.4 Å

PDB Description: crystal structure of human dpp-iv in complex withsa-(+)- methyl2-(3- (aminomethyl)-4-(2,4-dichlorophenyl)-2-methyl- 7-oxo-5h-pyrrolo[3,4- b]pyridin-6(7h)-yl)acetate
PDB Compounds: (A:) dipeptidyl peptidase 4

SCOPe Domain Sequences for d3q0ta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3q0ta1 b.70.3.1 (A:40-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
rktytltdylkntyrlklyslrwisdheylykqennilvfnaeygnssvflenstfdefg
hsindysispdgqfilleynyvkqwrhsytasydiydlnkrqliteeripnntqwvtwsp
vghklayvwnndiyvkiepnlpsyritwtgkediiyngitdwvyeeevfsaysalwwspn
gtflayaqfndtevplieysfysdeslqypktvrvpypkagavnptvkffvvntdslssv
tnatsiqitapasmligdhylcdvtwatqerislqwlrriqnysvmdicdydessgrwnc
lvarqhiemsttgwvgrfrpsephftldgnsfykiisneegyrhicyfqidkkdctfitk
gtwevigiealtsdylyyisneykgmpggrnlykiqlsdytkvtclscelnpercqyysv
sfskeakyyqlrcsgpglplytlhssvndkglrvlednsaldkmlqnvq

SCOPe Domain Coordinates for d3q0ta1:

Click to download the PDB-style file with coordinates for d3q0ta1.
(The format of our PDB-style files is described here.)

Timeline for d3q0ta1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3q0ta2