Lineage for d3pzva_ (3pzv A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2829818Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2832343Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. 2832344Protein automated matches [190075] (132 species)
    not a true protein
  7. 2832454Species Bacillus subtilis [TaxId:224308] [226199] (3 PDB entries)
  8. 2832459Domain d3pzva_: 3pzv A: [215000]
    automated match to d2cksa_

Details for d3pzva_

PDB Entry: 3pzv (more details), 2.87 Å

PDB Description: C2 crystal form of the endo-1,4-beta-glucanase from Bacillus subtilis 168
PDB Compounds: (A:) endoglucanase

SCOPe Domain Sequences for d3pzva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3pzva_ c.1.8.0 (A:) automated matches {Bacillus subtilis [TaxId: 224308]}
tpvakngqlsikgtqlvnrdgkavqlkgisshglqwygeyvnkdslkwlrddwgitvfra
amytadggyidnpsvknkvkeaveaakelgiyviidwhilndgnpnqnkekakeffkems
slygntpnviyeianepngdvnwkrdikpyaeevisvirkndpdniiivgtgtwsqdvnd
aaddqlkdanvmyalhfyagthgqflrdkanyalskgapifvtewgtsdasgnggvfldq
srewlkyldsktiswvnwnlsdkqesssalkpgasktggwrlsdlsasgtfvrenilg

SCOPe Domain Coordinates for d3pzva_:

Click to download the PDB-style file with coordinates for d3pzva_.
(The format of our PDB-style files is described here.)

Timeline for d3pzva_: