Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.42: Arginase/deacetylase [52767] (1 superfamily) 3 layers: a/b/a, parallel beta-sheet of 8 strands, order 21387456 |
Superfamily c.42.1: Arginase/deacetylase [52768] (3 families) |
Family c.42.1.0: automated matches [191435] (1 protein) not a true family |
Protein automated matches [190626] (14 species) not a true protein |
Species Thermoplasma volcanium [TaxId:273116] [226060] (1 PDB entry) |
Domain d3pzla_: 3pzl A: [214989] automated match to d2a0ma1 complexed with mn |
PDB Entry: 3pzl (more details), 2.7 Å
SCOPe Domain Sequences for d3pzla_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3pzla_ c.42.1.0 (A:) automated matches {Thermoplasma volcanium [TaxId: 273116]} aselrsifslkkiadavngyeeakyvvfgipfdntssyrrgskyapdsirgayvnlesye ysygidllasgmadlgdmeesedveyvidtvesvvsavmsdgkipimlggehsitvgavr alpkdvdlvivdahsdfrssymgnkynhacvtrraldllgegritsigirsvsreefedp dfrkvsfissfdvkkngidkyieevdrksrrvyisvdmdgidpayapavgtpepfgladt dvrrlierlsykavgfdivefsplydngntsmlaakllqvfiasrekyyk
Timeline for d3pzla_: