Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies) core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1 |
Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) N-terminal domain is the classic Rossmann-fold |
Family d.81.1.1: GAPDH-like [55348] (6 proteins) has many additional secondary structures |
Protein Aspartate beta-semialdehyde dehydrogenase [55361] (4 species) |
Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [143538] (18 PDB entries) Uniprot Q8DQ00 128-329 |
Domain d3pyxa2: 3pyx A:128-329 [214981] Other proteins in same PDB: d3pyxa1, d3pyxb1, d3pyxb3 automated match to d2gyya2 complexed with 12t, edo, na, nap |
PDB Entry: 3pyx (more details), 1.6 Å
SCOPe Domain Sequences for d3pyxa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3pyxa2 d.81.1.1 (A:128-329) Aspartate beta-semialdehyde dehydrogenase {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]} cstiqmmvalepvrqkwgldriivstyqavsgagmgailetqrelrevlndgvkpcdlha eilpsggdkkhypiafnalpqidvftdndytyeemkmtketkkimeddsiavsatcvrip vlsahsesvyietkevapieevkaaiaafpgavleddvahqiypqainavgsrdtfvgri rkdldaekgihmwvvsdnllkg
Timeline for d3pyxa2: