Lineage for d1mclb2 (1mcl B:112-216)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2356941Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2360924Protein Immunoglobulin light chain lambda constant domain, CL-lambda [88570] (3 species)
  7. 2360928Species Human (Homo sapiens) [TaxId:9606] [88572] (47 PDB entries)
  8. 2360994Domain d1mclb2: 1mcl B:112-216 [21497]
    Other proteins in same PDB: d1mcla1, d1mclb1
    part of the antibody MCG light chain dimer

Details for d1mclb2

PDB Entry: 1mcl (more details), 2.7 Å

PDB Description: principles and pitfalls in designing site directed peptide ligands
PDB Compounds: (B:) immunoglobulin lambda dimer mcg (light chain)

SCOPe Domain Sequences for d1mclb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mclb2 b.1.1.2 (B:112-216) Immunoglobulin light chain lambda constant domain, CL-lambda {Human (Homo sapiens) [TaxId: 9606]}
qpkanptvtlfppsseelqankatlvclisdfypgavtvawkadgspvkagvettkpskq
snnkyaassylsltpeqwkshrsyscqvthegstvektvaptecs

SCOPe Domain Coordinates for d1mclb2:

Click to download the PDB-style file with coordinates for d1mclb2.
(The format of our PDB-style files is described here.)

Timeline for d1mclb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1mclb1