Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein Immunoglobulin light chain lambda constant domain, CL-lambda [88570] (3 species) |
Species Human (Homo sapiens) [TaxId:9606] [88572] (46 PDB entries) |
Domain d1mclb2: 1mcl B:112-216 [21497] Other proteins in same PDB: d1mcla1, d1mclb1 part of the antibody MCG light chain dimer |
PDB Entry: 1mcl (more details), 2.7 Å
SCOPe Domain Sequences for d1mclb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mclb2 b.1.1.2 (B:112-216) Immunoglobulin light chain lambda constant domain, CL-lambda {Human (Homo sapiens) [TaxId: 9606]} qpkanptvtlfppsseelqankatlvclisdfypgavtvawkadgspvkagvettkpskq snnkyaassylsltpeqwkshrsyscqvthegstvektvaptecs
Timeline for d1mclb2: