Lineage for d3pwkb1 (3pwk B:2-127,B:330-358)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2843543Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins)
    family members also share a common alpha+beta fold in C-terminal domain
  6. 2843586Protein Aspartate beta-semialdehyde dehydrogenase [51813] (4 species)
  7. 2843617Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [141917] (18 PDB entries)
    Uniprot Q8DQ00 2-127,330-357
  8. 2843625Domain d3pwkb1: 3pwk B:2-127,B:330-358 [214956]
    Other proteins in same PDB: d3pwka2, d3pwkb2, d3pwkb3
    automated match to d2gyya1
    complexed with 25a, edo, l14, na

Details for d3pwkb1

PDB Entry: 3pwk (more details), 1.5 Å

PDB Description: crystal structure of aspartate beta-semialdehide dehydrogenase from streptococcus pneumoniae with 2',5'-adenosine diphosphate and d-2- aminoadipate
PDB Compounds: (B:) aspartate-semialdehyde dehydrogenase

SCOPe Domain Sequences for d3pwkb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3pwkb1 c.2.1.3 (B:2-127,B:330-358) Aspartate beta-semialdehyde dehydrogenase {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
gytvavvgatgavgaqmikmleestlpidkirylasarsagkslkfkdqditieetteta
fegvdialfsagsstsakyapyavkagvvvvdntsyfrqnpdvplvvpevnahaldahng
iiacpnXaawnsvqiaetlherglvrptaelkfelk

SCOPe Domain Coordinates for d3pwkb1:

Click to download the PDB-style file with coordinates for d3pwkb1.
(The format of our PDB-style files is described here.)

Timeline for d3pwkb1: