SCOPe 2.06: Domain d3puca1: 3puc A:2-98

Lineage for d3puca1 (3puc A:2-98)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (28 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (935 PDB entries)

8. Domain d3puca1: 3puc A:2-98 [214949]
   Other proteins in same PDB: d3puca2
   automated match to d1fhga_
   complexed with so4

Details for d3puca1

PDB Entry: 3puc, 0.96 Å

PDB Description: atomic resolution structure of titin domain m7

PDB Compounds: (A:) titin

SCOPe Domain Sequences for d3puca1:

Sequence; same for both SEQRES and ATOM records:

>d3puca1 b.1.1.0 (A:2-98) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pisskpvivtglqdttvssdsvakfavkatgeprptaiwtkdgkaitqggkyklsedkgg
ffleihktdtsdsglytctvknsagsvsssckltika

Timeline for d3puca1:

• d3puca1 first appeared in SCOPe 2.03, called d3puca_
  
• d3puca1 was called d3puca_ in SCOPe 2.05
  
• d3puca1 appears in SCOPe 2.07
  
• d3puca1 appears in the current release, SCOPe 2.08