Lineage for d3pqfd2 (3pqf D:148-314)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1680346Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 1680347Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) (S)
  5. 1680841Family d.162.1.0: automated matches [227146] (1 protein)
    not a true family
  6. 1680842Protein automated matches [226850] (24 species)
    not a true protein
  7. 1680860Species Bacillus subtilis [TaxId:1423] [226266] (3 PDB entries)
  8. 1680864Domain d3pqfd2: 3pqf D:148-314 [214932]
    Other proteins in same PDB: d3pqfa1, d3pqfb1, d3pqfc1, d3pqfd1
    automated match to d1llca2
    complexed with nad; mutant

Details for d3pqfd2

PDB Entry: 3pqf (more details), 2.49 Å

PDB Description: Crystal structure of L-lactate dehydrogenase from Bacillus subtilis mutation H171C complexed with NAD+
PDB Compounds: (D:) l-lactate dehydrogenase

SCOPe Domain Sequences for d3pqfd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3pqfd2 d.162.1.0 (D:148-314) automated matches {Bacillus subtilis [TaxId: 1423]}
ttldsarfrfmlseyfgaapqnvcahiigehgdtelpvwshanvggvpvselvekndayk
qeeldqivddvknaayhiiekkgatyygvamslaritkailhnensiltvstyldgqyga
ddvyigvpavvnrggiagitelnlnekekeqflhsagvlknilkphf

SCOPe Domain Coordinates for d3pqfd2:

Click to download the PDB-style file with coordinates for d3pqfd2.
(The format of our PDB-style files is described here.)

Timeline for d3pqfd2: