Lineage for d3pqfa1 (3pqf A:2-147)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1826588Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1826589Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1830524Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 1830525Protein automated matches [190069] (203 species)
    not a true protein
  7. 1830697Species Bacillus subtilis [TaxId:1423] [196388] (11 PDB entries)
  8. 1830713Domain d3pqfa1: 3pqf A:2-147 [214925]
    Other proteins in same PDB: d3pqfa2, d3pqfb2, d3pqfc2, d3pqfd2
    automated match to d1llca1
    complexed with nad; mutant

Details for d3pqfa1

PDB Entry: 3pqf (more details), 2.49 Å

PDB Description: Crystal structure of L-lactate dehydrogenase from Bacillus subtilis mutation H171C complexed with NAD+
PDB Compounds: (A:) l-lactate dehydrogenase

SCOPe Domain Sequences for d3pqfa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3pqfa1 c.2.1.0 (A:2-147) automated matches {Bacillus subtilis [TaxId: 1423]}
nkhvnkvaligagfvgssyafalinqgitdelvvidvnkekamgdvmdlnhgkafapqpv
ktsygtyedckdadivcicaganqkpgetrlelveknlkifkgivsevmasgfdgiflva
tnpvdiltyatwkfsglpkervigsg

SCOPe Domain Coordinates for d3pqfa1:

Click to download the PDB-style file with coordinates for d3pqfa1.
(The format of our PDB-style files is described here.)

Timeline for d3pqfa1: