SCOPe 2.08: Domain d3pqed2: 3pqe D:148-314

Lineage for d3pqed2 (3pqe D:148-314)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
   unusual fold, defines family

4. Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families)

5. Family d.162.1.0: automated matches [227146] (1 protein)
   not a true family

6. Protein automated matches [226850] (47 species)
   not a true protein

7. Species Bacillus subtilis [TaxId:1423] [226266] (3 PDB entries)

8. Domain d3pqed2: 3pqe D:148-314 [214924]
   Other proteins in same PDB: d3pqea1, d3pqeb1, d3pqec1, d3pqed1
   automated match to d1llca2
   mutant

Details for d3pqed2

PDB Entry: 3pqe, 2.2 Å

PDB Description: Crystal structure of L-lactate dehydrogenase from Bacillus subtilis with H171C mutation

PDB Compounds: (D:) l-lactate dehydrogenase

SCOPe Domain Sequences for d3pqed2:

Sequence, based on SEQRES records:

>d3pqed2 d.162.1.0 (D:148-314) automated matches {Bacillus subtilis [TaxId: 1423]}
ttldsarfrfmlseyfgaapqnvcahiigehgdtelpvwshanvggvpvselvekndayk
qeeldqivddvknaayhiiekkgatyygvamslaritkailhnensiltvstyldgqyga
ddvyigvpavvnrggiagitelnlnekekeqflhsagvlknilkphf

Sequence, based on observed residues (ATOM records):

>d3pqed2 d.162.1.0 (D:148-314) automated matches {Bacillus subtilis [TaxId: 1423]}
ttldsarfrfmlseyfgaapqnvcahiigehgdtelpvwshanvggvpvselvekndykq
eeldqivddvknaayhiiekkgatyygvamslaritkailhnensiltvstyldgqygad
dvyigvpavvnrggiagitelnlnekekeqflhsagvlknilkphf

Timeline for d3pqed2:

• d3pqed2 first appeared in SCOPe 2.03
  
• d3pqed2 appears in SCOPe 2.07