Lineage for d3pqea2 (3pqe A:148-315)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2556795Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 2556796Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) (S)
  5. 2557402Family d.162.1.0: automated matches [227146] (1 protein)
    not a true family
  6. 2557403Protein automated matches [226850] (36 species)
    not a true protein
  7. 2557421Species Bacillus subtilis [TaxId:1423] [226266] (3 PDB entries)
  8. 2557434Domain d3pqea2: 3pqe A:148-315 [214918]
    Other proteins in same PDB: d3pqea1, d3pqeb1, d3pqec1, d3pqed1
    automated match to d1llca2
    mutant

Details for d3pqea2

PDB Entry: 3pqe (more details), 2.2 Å

PDB Description: Crystal structure of L-lactate dehydrogenase from Bacillus subtilis with H171C mutation
PDB Compounds: (A:) l-lactate dehydrogenase

SCOPe Domain Sequences for d3pqea2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3pqea2 d.162.1.0 (A:148-315) automated matches {Bacillus subtilis [TaxId: 1423]}
ttldsarfrfmlseyfgaapqnvcahiigehgdtelpvwshanvggvpvselvekndayk
qeeldqivddvknaayhiiekkgatyygvamslaritkailhnensiltvstyldgqyga
ddvyigvpavvnrggiagitelnlnekekeqflhsagvlknilkphfa

SCOPe Domain Coordinates for d3pqea2:

Click to download the PDB-style file with coordinates for d3pqea2.
(The format of our PDB-style files is described here.)

Timeline for d3pqea2: