Class b: All beta proteins [48724] (110 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (6 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
Protein Immunoglobulin (constant domains of L and H chains) [48972] (169 species) |
Species Lambda L chain dimer MCG (human) [49117] (18 PDB entries) |
Domain d1mccb2: 1mcc B:112-216 [21491] Other proteins in same PDB: d1mcca1, d1mccb1 |
PDB Entry: 1mcc (more details), 2.7 Å
SCOP Domain Sequences for d1mccb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mccb2 b.1.1.2 (B:112-216) Immunoglobulin (constant domains of L and H chains) {Lambda L chain dimer MCG (human)} qpkanptvtlfppsseelqankatlvclisdfypgavtvawkadgspvkagvettkpskq snnkyaassylsltpeqwkshrsyscqvthegstvektvaptecs
Timeline for d1mccb2: