Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
Protein automated matches [190069] (319 species) not a true protein |
Species Bacillus subtilis [TaxId:1423] [196388] (13 PDB entries) |
Domain d3pqda1: 3pqd A:3-147 [214901] Other proteins in same PDB: d3pqda2, d3pqdb2, d3pqdc2, d3pqdd2, d3pqde2, d3pqdf2, d3pqdg2, d3pqdh2 automated match to d1llca1 complexed with fbp, nad |
PDB Entry: 3pqd (more details), 2.38 Å
SCOPe Domain Sequences for d3pqda1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3pqda1 c.2.1.0 (A:3-147) automated matches {Bacillus subtilis [TaxId: 1423]} khvnkvaligagfvgssyafalinqgitdelvvidvnkekamgdvmdlnhgkafapqpvk tsygtyedckdadivcicaganqkpgetrlelveknlkifkgivsevmasgfdgiflvat npvdiltyatwkfsglpkervigsg
Timeline for d3pqda1: