Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) the beta-sheet barrel is similarly distorted and capped by a C-terminal helix has transition metal ions bound inside the barrel |
Family c.1.9.0: automated matches [191327] (1 protein) not a true family |
Protein automated matches [190150] (36 species) not a true protein |
Species Campylobacter jejuni [TaxId:192222] [226030] (1 PDB entry) |
Domain d3pnub1: 3pnu B:1-335 [214882] Other proteins in same PDB: d3pnua2, d3pnub2 automated match to d2z29b_ complexed with po4, zn |
PDB Entry: 3pnu (more details), 2.4 Å
SCOPe Domain Sequences for d3pnub1:
Sequence, based on SEQRES records: (download)
>d3pnub1 c.1.9.0 (B:1-335) automated matches {Campylobacter jejuni [TaxId: 192222]} mklknpldmhlhlrdnqmleliaplsardfcaavimpnlipplcnledlkaykmrilkac kdenftplmtlffknydekflysakdeifgiklypagittnsnggvssfdieylkptlea msdlnipllvhgetndfvmdresnfakiyeklakhfprlkivmehittktlcellkdyen lyatitlhhliitlddviggkmnphlfckpiakryedkealcelafsgyekvmfgsdsap hpkdtkeccgcaagvfsapvilpvlaelfkqnsseenlqkflsdntckiydlkfkedkil tleekewqvpnvyedkynqvvpymageilkfqlkh
>d3pnub1 c.1.9.0 (B:1-335) automated matches {Campylobacter jejuni [TaxId: 192222]} mklknpldmhlhlrdnqmleliaplsardfcaavimpnlipplcnledlkaykmrilkac kdenftplmtlffknydekflysakdeifgiklypagittnssfdieylkptleamsdln ipllvhgetndfvmdresnfakiyeklakhfprlkivmehittktlcellkdyenlyati tlhhliitlddviggkmnphlfckpiakryedkealcelafsgyekvmfgsdsaphpkdg caagvfsapvilpvlaelfkqnsseenlqkflsdntckiydlkfkedkiltleekewqvp nvyedkynqvvpymageilkfqlkh
Timeline for d3pnub1: