SCOPe 2.07: Domain d3pnbb_: 3pnb B:

Lineage for d3pnbb_ (3pnb B:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
   core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families)

5. Family c.26.1.0: automated matches [191377] (1 protein)
   not a true family

6. Protein automated matches [190459] (59 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:1773] [226769] (5 PDB entries)

8. Domain d3pnbb_: 3pnb B: [214878]
   automated match to d3f3ma_
   complexed with coa

Details for d3pnbb_

PDB Entry: 3pnb, 2.11 Å

PDB Description: Phosphopantetheine Adenylyltransferase from Mycobacterium tuberculosis in complex with coenzyme A

PDB Compounds: (B:) phosphopantetheine adenylyltransferase

SCOPe Domain Sequences for d3pnbb_:

Sequence; same for both SEQRES and ATOM records:

>d3pnbb_ c.26.1.0 (B:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
mtgavcpgsfdpvtlghvdiferaaaqfdevvvailvnpaktgmfdlderiamvkestth
lpnlrvqvghglvvdfvrscgmtaivkglrtgtdfeyelqmaqmnkhiagvdtffvatap
rysfvssslakevamlggdvsellpepvnrrlrdrln

Timeline for d3pnbb_:

• d3pnbb_ first appeared in SCOPe 2.03
  
• d3pnbb_ appears in SCOPe 2.06
  
• d3pnbb_ appears in the current release, SCOPe 2.08