Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (19 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187920] (522 PDB entries) |
Domain d3pl6c1: 3pl6 C:2-113 [214854] Other proteins in same PDB: d3pl6a1, d3pl6b1, d3pl6b2, d3pl6c2 automated match to d1qrnd1 complexed with nag |
PDB Entry: 3pl6 (more details), 2.55 Å
SCOPe Domain Sequences for d3pl6c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3pl6c1 b.1.1.0 (C:2-113) automated matches {Human (Homo sapiens) [TaxId: 9606]} enveqhpstlsvqegdsavikctysdsasnyfpwykqelgkrpqliidirsnvgekkdqr iavtlnktakhfslhitetqpedsavyfcaassfgnekltfgtgtrltiipn
Timeline for d3pl6c1:
View in 3D Domains from other chains: (mouse over for more information) d3pl6a1, d3pl6a2, d3pl6b1, d3pl6b2 |