SCOPe 2.05: Domain d3pl6b1: 3pl6 B:3-94

Lineage for d3pl6b1 (3pl6 B:3-94)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)

6. Protein automated matches [191280] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189896] (24 PDB entries)

8. Domain d3pl6b1: 3pl6 B:3-94 [214852]
   Other proteins in same PDB: d3pl6a1, d3pl6a2, d3pl6b2, d3pl6c1, d3pl6c2
   automated match to d1uvqb2
   complexed with nag

Details for d3pl6b1

PDB Entry: 3pl6, 2.55 Å

PDB Description: structure of autoimmune tcr hy.1b11 in complex with hla-dq1 and mbp 85-99

PDB Compounds: (B:) MHC class II HLA-DQ-beta chain

SCOPe Domain Sequences for d3pl6b1:

Sequence; same for both SEQRES and ATOM records:

>d3pl6b1 d.19.1.1 (B:3-94) automated matches {Human (Homo sapiens) [TaxId: 9606]}
spedfvyqfkglcyftngtervrgvtrhiynreeyvrfdsdvgvyravtpqgrpvaeywn
sqkevlegarasvdrvcrhnyevayrgilqrr

Timeline for d3pl6b1:

• d3pl6b1 first appeared in SCOPe 2.03
  
• d3pl6b1 appears in SCOPe 2.04
  
• d3pl6b1 appears in SCOPe 2.06
  
• d3pl6b1 appears in the current release, SCOPe 2.08