Lineage for d3pl6a2 (3pl6 A:82-180)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2365354Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2365355Protein automated matches [190740] (29 species)
    not a true protein
  7. 2365565Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries)
  8. 2368473Domain d3pl6a2: 3pl6 A:82-180 [214851]
    Other proteins in same PDB: d3pl6a1, d3pl6b1, d3pl6b2, d3pl6c2
    automated match to d1d9kc1
    complexed with nag

Details for d3pl6a2

PDB Entry: 3pl6 (more details), 2.55 Å

PDB Description: structure of autoimmune tcr hy.1b11 in complex with hla-dq1 and mbp 85-99
PDB Compounds: (A:) MHC class II HLA-DQ-alpha chain

SCOPe Domain Sequences for d3pl6a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3pl6a2 b.1.1.0 (A:82-180) automated matches {Human (Homo sapiens) [TaxId: 9606]}
atnevpevtvfskspvtlgqpntliclvdnifppvvnitwlsngqsvtegvsetsflsks
dhsffkisyltflpsadeiydckvehwgldqpllkhwep

SCOPe Domain Coordinates for d3pl6a2:

Click to download the PDB-style file with coordinates for d3pl6a2.
(The format of our PDB-style files is described here.)

Timeline for d3pl6a2: