SCOPe 2.08: Domain d3pl6a1: 3pl6 A:-1-81

Lineage for d3pl6a1 (3pl6 A:-1-81)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.0: automated matches [227140] (1 protein)
   not a true family

6. Protein automated matches [226842] (5 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [226044] (107 PDB entries)

8. Domain d3pl6a1: 3pl6 A:-1-81 [214850]
   Other proteins in same PDB: d3pl6a2, d3pl6b1, d3pl6b2, d3pl6c1, d3pl6c2
   automated match to d1iaka2
   complexed with nag

Details for d3pl6a1

PDB Entry: 3pl6, 2.55 Å

PDB Description: structure of autoimmune tcr hy.1b11 in complex with hla-dq1 and mbp 85-99

PDB Compounds: (A:) MHC class II HLA-DQ-alpha chain

SCOPe Domain Sequences for d3pl6a1:

Sequence; same for both SEQRES and ATOM records:

>d3pl6a1 d.19.1.0 (A:-1-81) automated matches {Human (Homo sapiens) [TaxId: 9606]}
divadhvascgvnlyqfygpsgqythefdgdeqfyvdlerketawrwpefskfggfdpqg
alrnmavakhnlnimikrynsta

Timeline for d3pl6a1:

• d3pl6a1 first appeared in SCOPe 2.03
  
• d3pl6a1 appears in SCOPe 2.07