Lineage for d1mcba2 (1mcb A:112-216)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1513476Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1516956Protein Immunoglobulin light chain lambda constant domain, CL-lambda [88570] (3 species)
  7. 1516960Species Human (Homo sapiens) [TaxId:9606] [88572] (46 PDB entries)
  8. 1517003Domain d1mcba2: 1mcb A:112-216 [21482]
    Other proteins in same PDB: d1mcba1, d1mcbb1
    part of the antibody MCG light chain dimer

Details for d1mcba2

PDB Entry: 1mcb (more details), 2.7 Å

PDB Description: principles and pitfalls in designing site directed peptide ligands
PDB Compounds: (A:) immunoglobulin lambda dimer mcg (light chain)

SCOPe Domain Sequences for d1mcba2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mcba2 b.1.1.2 (A:112-216) Immunoglobulin light chain lambda constant domain, CL-lambda {Human (Homo sapiens) [TaxId: 9606]}
qpkanptvtlfppsseelqankatlvclisdfypgavtvawkadgspvkagvettkpskq
snnkyaassylsltpeqwkshrsyscqvthegstvektvaptecs

SCOPe Domain Coordinates for d1mcba2:

Click to download the PDB-style file with coordinates for d1mcba2.
(The format of our PDB-style files is described here.)

Timeline for d1mcba2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1mcba1