Lineage for d3pk6a2 (3pk6 A:137-295)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2966179Fold d.96: T-fold [55619] (2 superfamilies)
    beta(2)-alpha(2)-beta(2); 2 layers: alpha/beta; antiparallel sheet 1234
    tunnel-shaped: its known members form wide oligomeric barrels different sizes
  4. 2966180Superfamily d.96.1: Tetrahydrobiopterin biosynthesis enzymes-like [55620] (5 families) (S)
    bind purine or pterin in topologically similar sites between subunits
  5. 2966494Family d.96.1.4: Urate oxidase (uricase) [55633] (2 proteins)
    automatically mapped to Pfam PF01014
  6. 2966495Protein Urate oxidase (uricase) [55634] (3 species)
    duplication: one subunit consists of two domains of this fold; beta-sheets of two subunits form a barrel, closed: n=16, S=16
  7. 2966529Species Aspergillus flavus [TaxId:5059] [55635] (71 PDB entries)
  8. 2966647Domain d3pk6a2: 3pk6 A:137-295 [214819]
    automated match to d1r4ua2
    complexed with aza, na, xe

Details for d3pk6a2

PDB Entry: 3pk6 (more details), 1.8 Å

PDB Description: urate oxidase under 0.2 mpa / 2 bars pressure of xenon
PDB Compounds: (A:) Uricase

SCOPe Domain Sequences for d3pk6a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3pk6a2 d.96.1.4 (A:137-295) Urate oxidase (uricase) {Aspergillus flavus [TaxId: 5059]}
gkgidiksslsgltvlkstnsqfwgflrdeyttlketwdrilstdvdatwqwknfsglqe
vrshvpkfdatwatarevtlktfaednsasvqatmykmaeqilarqqlietveyslpnkh
yfeidlswhkglqntgknaevfapqsdpnglikctvgrs

SCOPe Domain Coordinates for d3pk6a2:

Click to download the PDB-style file with coordinates for d3pk6a2.
(The format of our PDB-style files is described here.)

Timeline for d3pk6a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3pk6a1