Lineage for d3pjqa1 (3pjq A:-1-399)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1802176Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 1802177Superfamily b.68.1: Sialidases [50939] (3 families) (S)
  5. 1802178Family b.68.1.1: Sialidases (neuraminidases) [50940] (10 proteins)
  6. 1802440Protein automated matches [193245] (15 species)
    not a true protein
  7. 1802555Species Trypanosoma cruzi [TaxId:5693] [226151] (1 PDB entry)
  8. 1802556Domain d3pjqa1: 3pjq A:-1-399 [214810]
    Other proteins in same PDB: d3pjqa2
    automated match to d1n1ta2
    complexed with lbt; mutant

Details for d3pjqa1

PDB Entry: 3pjq (more details), 2.1 Å

PDB Description: trypanosoma cruzi trans-sialidase-like inactive isoform (including the natural mutation tyr342his) in complex with lactose
PDB Compounds: (A:) Trans-sialidase

SCOPe Domain Sequences for d3pjqa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3pjqa1 b.68.1.1 (A:-1-399) automated matches {Trypanosoma cruzi [TaxId: 5693]}
aslapgssrvelfkrqsskvpfekdgkvtervvhsfrlpalvnvdgvmvaiadaryetsf
dnslidtvakysvddgetwetqiaiknsrassvsrvvdptvivkgnklyvlvgsynssrs
ywtshgdardwdillavgevtkstaggkitasikwgspvslkeffpaemegmhtnqflgg
agvaivasngnlvypvqvtnkkkqvfskifysedegktwkfgkgrsafgcsepvaleweg
kliintrvdyrrrlvyessdmgntwleavgtlsrvwgpspksnqpgsqssftavtiegmr
vmlfthplnfkgrwlrdrlnlwltdnqriynvgqvsigdensahssvlykddklyclhei
nsnevyslvfarlvgelriiksvlqswknwdshlssictpa

SCOPe Domain Coordinates for d3pjqa1:

Click to download the PDB-style file with coordinates for d3pjqa1.
(The format of our PDB-style files is described here.)

Timeline for d3pjqa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3pjqa2