SCOPe 2.07: Domain d1mckb2: 1mck B:112-216

Lineage for d1mckb2 (1mck B:112-216)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Immunoglobulin light chain lambda constant domain, CL-lambda [88570] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88572] (47 PDB entries)

8. Domain d1mckb2: 1mck B:112-216 [21481]
   Other proteins in same PDB: d1mcka1, d1mckb1
   part of the antibody MCG light chain dimer

Details for d1mckb2

PDB Entry: 1mck, 2.7 Å

PDB Description: principles and pitfalls in designing site directed peptide ligands

PDB Compounds: (B:) immunoglobulin lambda dimer mcg (light chain)

SCOPe Domain Sequences for d1mckb2:

Sequence; same for both SEQRES and ATOM records:

>d1mckb2 b.1.1.2 (B:112-216) Immunoglobulin light chain lambda constant domain, CL-lambda {Human (Homo sapiens) [TaxId: 9606]}
qpkanptvtlfppsseelqankatlvclisdfypgavtvawkadgspvkagvettkpskq
snnkyaassylsltpeqwkshrsyscqvthegstvektvaptecs

Timeline for d1mckb2:

• d1mckb2 first appeared (with stable ids) in SCOP 1.55
  
• d1mckb2 appears in SCOPe 2.06
  
• d1mckb2 appears in the current release, SCOPe 2.08