Lineage for d3phqa1 (3phq A:2-110)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2759478Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)
  8. 2759785Domain d3phqa1: 3phq A:2-110 [214802]
    Other proteins in same PDB: d3phqa2, d3phqb_
    automated match to d1dqdl1
    complexed with kdo

Details for d3phqa1

PDB Entry: 3phq (more details), 2 Å

PDB Description: crystal structure of s64-4 in complex with kdo
PDB Compounds: (A:) S64-4 Fab (IgG1) light chain

SCOPe Domain Sequences for d3phqa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3phqa1 b.1.1.0 (A:2-110) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
ivltqspaslavslgqratiscrasksvsssvnsymhwyqqkpgqppklliylasnlesg
vparfsgsgsgtdftlnihpveeedaatyycqhsrelrtfgggtkleik

SCOPe Domain Coordinates for d3phqa1:

Click to download the PDB-style file with coordinates for d3phqa1.
(The format of our PDB-style files is described here.)

Timeline for d3phqa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3phqa2
View in 3D
Domains from other chains:
(mouse over for more information)
d3phqb_