![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
![]() | Protein Immunoglobulin light chain lambda constant domain, CL-lambda [88570] (3 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [88572] (47 PDB entries) |
![]() | Domain d1mcka2: 1mck A:112-216 [21480] Other proteins in same PDB: d1mcka1, d1mckb1 part of the antibody MCG light chain dimer |
PDB Entry: 1mck (more details), 2.7 Å
SCOPe Domain Sequences for d1mcka2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mcka2 b.1.1.2 (A:112-216) Immunoglobulin light chain lambda constant domain, CL-lambda {Human (Homo sapiens) [TaxId: 9606]} qpkanptvtlfppsseelqankatlvclisdfypgavtvawkadgspvkagvettkpskq snnkyaassylsltpeqwkshrsyscqvthegstvektvaptecs
Timeline for d1mcka2: