Lineage for d3pg8a_ (3pg8 A:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1336838Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1342158Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 1342981Family c.1.10.4: Class I DAHP synthetase [51599] (3 proteins)
  6. 1343178Protein automated matches [190083] (7 species)
    not a true protein
  7. 1343274Species Thermotoga maritima [TaxId:2336] [186804] (3 PDB entries)
  8. 1343279Domain d3pg8a_: 3pg8 A: [214765]
    automated match to d1o60a_
    complexed with azi, gol

Details for d3pg8a_

PDB Entry: 3pg8 (more details), 2 Å

PDB Description: Truncated form of 3-deoxy-D-arabino-heptulosonate 7-phosphate synthase from Thermotoga maritima
PDB Compounds: (A:) phospho-2-dehydro-3-deoxyheptonate aldolase

SCOPe Domain Sequences for d3pg8a_:

Sequence, based on SEQRES records: (download)

>d3pg8a_ c.1.10.4 (A:) automated matches {Thermotoga maritima [TaxId: 2336]}
gsftlvsrefhpedtvidlgdvkigngyftiiagpcsvegremlmetahflselgvkvlr
ggaykprtspysfqglgekgleylreaadkygmyvvtealgeddlpkvaeyadiiqigar
naqnfrllskagsynkpvllkrgfmntieefllsaeyiansgntkiilcergirtfekat
rntldisavpiirkeshlpilvdpshsggrrdlviplsraaiavgahgiivevhpepeka
lsdgkqsldfelfkelvqemkkladalgvkvn

Sequence, based on observed residues (ATOM records): (download)

>d3pg8a_ c.1.10.4 (A:) automated matches {Thermotoga maritima [TaxId: 2336]}
gsftlvsrefhpedtvidlgdvkigngyftiiagpcsvegremlmetahflselgvkvlr
ggaykprglgekgleylreaadkygmyvvtealgeddlpkvaeyadiiqigarnaqnfrl
lskagsynkpvllkrgfmntieefllsaeyiansgntkiilcergirtfekatrntldis
avpiirkeshlpilvdpshsggrrdlviplsraaiavgahgiivevhpepekalsdgkqs
ldfelfkelvqemkkladalgvkvn

SCOPe Domain Coordinates for d3pg8a_:

Click to download the PDB-style file with coordinates for d3pg8a_.
(The format of our PDB-style files is described here.)

Timeline for d3pg8a_:

Domains from other chains:
(mouse over for more information)
d3pg8b_