Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds) |
Fold e.6: Acyl-CoA dehydrogenase NM domain-like [56644] (1 superfamily) 2 domains: (1) all-alpha: 5 helices; (2) contains an open beta-sheet barrel: n*=5, S*=8; complex topology |
Superfamily e.6.1: Acyl-CoA dehydrogenase NM domain-like [56645] (3 families) flavoprotein: binds FAD; constituent families differ in the numbers of C-terminal domains (four-helical bundles) |
Family e.6.1.0: automated matches [227203] (1 protein) not a true family |
Protein automated matches [226934] (29 species) not a true protein |
Species Mycobacterium thermoresistibile [TaxId:1797] [225912] (2 PDB entries) |
Domain d3pfdd1: 3pfd D:18-238 [214762] Other proteins in same PDB: d3pfda2, d3pfdb2, d3pfdc2, d3pfdd2 automated match to d1jqia2 complexed with fda, iod |
PDB Entry: 3pfd (more details), 2.1 Å
SCOPe Domain Sequences for d3pfdd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3pfdd1 e.6.1.0 (D:18-238) automated matches {Mycobacterium thermoresistibile [TaxId: 1797]} ehialreairalaekeiapyaaevdekarfpeealaalnssgfsaihvpeeyggqgadsv atcivieevarvdcsaslipavnklgtmglilrgseelkkqvlpavasgeamasyalser eagsdaasmrtravadgddwilngskcwitnggkstwytvmavtdpdkgangisafmvhk ddegftvgpkerklgikgspttelyfencripgdriigepg
Timeline for d3pfdd1: