Lineage for d3pfdb2 (3pfd B:239-389)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1731436Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 1731940Superfamily a.29.3: Acyl-CoA dehydrogenase C-terminal domain-like [47203] (3 families) (S)
    multidomain flavoprotein; N-terminal domain is all-alpha; the middle domain is open (5,8) barrel
  5. 1732074Family a.29.3.0: automated matches [227204] (1 protein)
    not a true family
  6. 1732075Protein automated matches [226935] (21 species)
    not a true protein
  7. 1732188Species Mycobacterium thermoresistibile [TaxId:1797] [225913] (2 PDB entries)
  8. 1732190Domain d3pfdb2: 3pfd B:239-389 [214759]
    Other proteins in same PDB: d3pfda1, d3pfdb1, d3pfdc1, d3pfdd1
    automated match to d1jqia1
    complexed with fda, iod

Details for d3pfdb2

PDB Entry: 3pfd (more details), 2.1 Å

PDB Description: crystal structure of an acyl-coa dehydrogenase from mycobacterium thermoresistibile bound to reduced flavin adenine dinucleotide solved by combined iodide ion sad mr
PDB Compounds: (B:) acyl-CoA dehydrogenase

SCOPe Domain Sequences for d3pfdb2:

Sequence, based on SEQRES records: (download)

>d3pfdb2 a.29.3.0 (B:239-389) automated matches {Mycobacterium thermoresistibile [TaxId: 1797]}
tgfktalatldhtrptigaqavgiaqgaldaaiaytkerkqfgrpvsdnqgvqfmladma
mkieaarlmvysaaaraergegdlgfisaaskcfasdvamevttdavqlfggygytqdfp
vermmrdakitqiyegtnqiqrvvmsrallr

Sequence, based on observed residues (ATOM records): (download)

>d3pfdb2 a.29.3.0 (B:239-389) automated matches {Mycobacterium thermoresistibile [TaxId: 1797]}
tgfktalatldhtrptigaqavgiaqgaldaaiaytkerkqfgrpvsdnqgvqfmladma
mkieaarlmvysaaaraerggfisaaskcfasdvamevttdavqlfggygytqdfpverm
mrdakitqiyegtnqiqrvvmsrallr

SCOPe Domain Coordinates for d3pfdb2:

Click to download the PDB-style file with coordinates for d3pfdb2.
(The format of our PDB-style files is described here.)

Timeline for d3pfdb2: