Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.169: C-type lectin-like [56435] (1 superfamily) unusual fold |
Superfamily d.169.1: C-type lectin-like [56436] (9 families) |
Family d.169.1.1: C-type lectin domain [56437] (29 proteins) Pfam PF00059 |
Protein Surfactant protein, lectin domain [56461] (3 species) |
Species Norway rat (Rattus norvegicus), SP-A [TaxId:10116] [103352] (6 PDB entries) |
Domain d3paka2: 3pak A:110-228 [214741] Other proteins in same PDB: d3paka1 automated match to d1r13a1 complexed with ca, man, na, so4 |
PDB Entry: 3pak (more details), 1.9 Å
SCOPe Domain Sequences for d3paka2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3paka2 d.169.1.1 (A:110-228) Surfactant protein, lectin domain {Norway rat (Rattus norvegicus), SP-A [TaxId: 10116]} smlsvgdkvfstngqsvnfdtikemctraggniavprtpeeneaiasiakkynnyvylgm iedqtpgdfhyldgasvsytnwypgeprgqgkekcvemytdgtwndrgclqyrlavcef
Timeline for d3paka2: