Lineage for d2mcg12 (2mcg 1:112-216)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1758822Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1762390Protein Immunoglobulin light chain lambda constant domain, CL-lambda [88570] (3 species)
  7. 1762394Species Human (Homo sapiens) [TaxId:9606] [88572] (46 PDB entries)
  8. 1762421Domain d2mcg12: 2mcg 1:112-216 [21474]
    Other proteins in same PDB: d2mcg11, d2mcg21
    part of the antibody MCG light chain dimer

Details for d2mcg12

PDB Entry: 2mcg (more details), 2 Å

PDB Description: three-dimensional structure of a light chain dimer crystallized in water. conformational flexibility of a molecule in two crystal forms
PDB Compounds: (1:) immunoglobulin lambda dimer mcg (light chain)

SCOPe Domain Sequences for d2mcg12:

Sequence; same for both SEQRES and ATOM records: (download)

>d2mcg12 b.1.1.2 (1:112-216) Immunoglobulin light chain lambda constant domain, CL-lambda {Human (Homo sapiens) [TaxId: 9606]}
qpkanptvtlfppsseelqankatlvclisdfypgavtvawkadgspvkagvettkpskq
snnkyaassylsltpeqwkshrsyscqvthegstvektvaptecs

SCOPe Domain Coordinates for d2mcg12:

Click to download the PDB-style file with coordinates for d2mcg12.
(The format of our PDB-style files is described here.)

Timeline for d2mcg12:

View in 3D
Domains from same chain:
(mouse over for more information)
d2mcg11