Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest |
Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (58 families) |
Family c.66.1.0: automated matches [191451] (1 protein) not a true family |
Protein automated matches [190689] (49 species) not a true protein |
Species Lolium perenne [TaxId:4522] [226054] (3 PDB entries) |
Domain d3p9kb2: 3p9k B:117-360 [214725] Other proteins in same PDB: d3p9ka1, d3p9kb1, d3p9kc1, d3p9kd1 automated match to d1kyzc2 complexed with ciy, sah |
PDB Entry: 3p9k (more details), 2.25 Å
SCOPe Domain Sequences for d3p9kb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3p9kb2 c.66.1.0 (B:117-360) automated matches {Lolium perenne [TaxId: 4522]} dgvsmaalalmnqdkvlmeswyylkdavldggipfnkaygmsafeyhgtdprfnrvfneg mknhsiiitkkllelyhgfeglgtlvdvgggvgatvaaiaahyptikgvnfdlphvisea pqfpgvthvggdmfkevpsgdtilmkwilhdwsdqhcatllkncydalpahgkvvlvqci lpvnpeanpssqgvfhvdmimlahnpggreryerefqalargagftgvkstyiyanawai eftk
Timeline for d3p9kb2: