Lineage for d3p9id2 (3p9i D:117-360)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1611695Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 1611696Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (58 families) (S)
  5. 1612879Family c.66.1.0: automated matches [191451] (1 protein)
    not a true family
  6. 1612880Protein automated matches [190689] (47 species)
    not a true protein
  7. 1613015Species Lolium perenne [TaxId:4522] [226054] (3 PDB entries)
  8. 1613020Domain d3p9id2: 3p9i D:117-360 [214721]
    Other proteins in same PDB: d3p9ia1, d3p9ib1, d3p9ic1, d3p9id1
    automated match to d1kyzc2
    complexed with bme, sah, sny

Details for d3p9id2

PDB Entry: 3p9i (more details), 1.85 Å

PDB Description: crystal structure of perennial ryegrass lpomt1 complexed with s- adenosyl-l-homocysteine and sinapaldehyde
PDB Compounds: (D:) Caffeic acid O-methyltransferase

SCOPe Domain Sequences for d3p9id2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3p9id2 c.66.1.0 (D:117-360) automated matches {Lolium perenne [TaxId: 4522]}
dgvsmaalalmnqdkvlmeswyylkdavldggipfnkaygmsafeyhgtdprfnrvfneg
mknhsiiitkkllelyhgfeglgtlvdvgggvgatvaaiaahyptikgvnfdlphvisea
pqfpgvthvggdmfkevpsgdtilmkwilhdwsdqhcatllkncydalpahgkvvlvqci
lpvnpeanpssqgvfhvdmimlahnpggreryerefqalargagftgvkstyiyanawai
eftk

SCOPe Domain Coordinates for d3p9id2:

Click to download the PDB-style file with coordinates for d3p9id2.
(The format of our PDB-style files is described here.)

Timeline for d3p9id2: