SCOPe 2.06: Domain d3p9ia1: 3p9i A:4-116

Lineage for d3p9ia1 (3p9i A:4-116)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.0: automated matches [191329] (1 protein)
   not a true family

6. Protein automated matches [190154] (68 species)
   not a true protein

7. Species Lolium perenne [TaxId:4522] [226053] (3 PDB entries)

8. Domain d3p9ia1: 3p9i A:4-116 [214714]
   Other proteins in same PDB: d3p9ia2, d3p9ib2, d3p9ic2, d3p9id2
   automated match to d1kyze1
   complexed with bme, sah, sny

Details for d3p9ia1

PDB Entry: 3p9i, 1.85 Å

PDB Description: crystal structure of perennial ryegrass lpomt1 complexed with s- adenosyl-l-homocysteine and sinapaldehyde

PDB Compounds: (A:) Caffeic acid O-methyltransferase

SCOPe Domain Sequences for d3p9ia1:

Sequence; same for both SEQRES and ATOM records:

>d3p9ia1 a.4.5.0 (A:4-116) automated matches {Lolium perenne [TaxId: 4522]}
taadmaasadedacmfalqlasssvlpmtlknaielglleilvaaggksltptevaaklp
saanpeapdmvdrilrllasynvvtclveegkdgrlsrsygaapvckfltpne

Timeline for d3p9ia1:

• d3p9ia1 first appeared in SCOPe 2.03
  
• d3p9ia1 appears in SCOPe 2.05
  
• d3p9ia1 appears in SCOPe 2.07
  
• d3p9ia1 appears in the current release, SCOPe 2.08