SCOP 1.73: Domain d1mcoh3: 1mco H:220-327

Lineage for d1mcoh3 (1mco H:220-327)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma [88584] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88585] (25 PDB entries)

8. Domain d1mcoh3: 1mco H:220-327 [21470]
   Other proteins in same PDB: d1mcoh1, d1mcoh2, d1mcoh4, d1mcol1, d1mcol2
   part of intact antibody MCG
   complexed with fuc, gal, man, nag, sia

Details for d1mcoh3

PDB Entry: 1mco, 3.2 Å

PDB Description: three-dimensional structure of a human immunoglobulin with a hinge deletion

PDB Compounds: (H:) igg1 mcg intact antibody (heavy chain)

SCOP Domain Sequences for d1mcoh3:

Sequence; same for both SEQRES and ATOM records:

>d1mcoh3 b.1.1.2 (H:220-327) Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma {Human (Homo sapiens) [TaxId: 9606]}
lggpsvflfppkpkdtlmisrtpevtcvvvdvshedpqvkfnwyvdgvqvhnaktkpreq
qynstyrvvsvltvlhqnwldgkeykckvsnkalpapiektiskakgq

Timeline for d1mcoh3:

• d1mcoh3 first appeared (with stable ids) in SCOP 1.55
  
• d1mcoh3 appears in SCOP 1.71
  
• d1mcoh3 appears in SCOP 1.75
  
• d1mcoh3 appears in the current release, SCOPe 2.08