SCOPe 2.08: Domain d3p8ka1: 3p8k A:2-261

Lineage for d3p8ka1 (3p8k A:2-261)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.160: Carbon-nitrogen hydrolase [56316] (1 superfamily)
   4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication

4. Superfamily d.160.1: Carbon-nitrogen hydrolase [56317] (3 families)
   Pfam PF00795; some topological similarities to the metallo-dependent phosphatases and DNase I-like nucleases

5. Family d.160.1.0: automated matches [191429] (1 protein)
   not a true family

6. Protein automated matches [190617] (6 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:93062] [226232] (1 PDB entry)

8. Domain d3p8ka1: 3p8k A:2-261 [214695]
   Other proteins in same PDB: d3p8ka2, d3p8kb2
   automated match to d1f89a_
   complexed with cl, gol, peg, pge, trs

Details for d3p8ka1

PDB Entry: 3p8k, 1.7 Å

PDB Description: Crystal Structure of a putative carbon-nitrogen family hydrolase from Staphylococcus aureus

PDB Compounds: (A:) Hydrolase, carbon-nitrogen family

SCOPe Domain Sequences for d3p8ka1:

Sequence; same for both SEQRES and ATOM records:

>d3p8ka1 d.160.1.0 (A:2-261) automated matches {Staphylococcus aureus [TaxId: 93062]}
kvqiyqlpivfgdssknetqitqwfeknmnaevdvvvlpemwnngydlehlnekadnnlg
qsfsfikhlaekykvdivagsvsnirnnqifntafsvnksgqlineydkvhlvpmlrehe
fltageyvaepfqlsdgtyvtqlicydlrfpellryparsgakiafyvaqwpmsrlqhwh
sllkaraiennmfvigtnstgfdgnteyaghsivinpngdlvgelnesadiltvdlnlne
veqqrenipvfksikldlyk

Timeline for d3p8ka1:

• d3p8ka1 first appeared in SCOPe 2.03, called d3p8ka_
  
• d3p8ka1 appears in SCOPe 2.07