SCOPe 2.03: Domain d3p7mc2: 3p7m C:146-318

Lineage for d3p7mc2 (3p7m C:146-318)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
   unusual fold, defines family

4. Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families)

5. Family d.162.1.0: automated matches [227146] (1 protein)
   not a true family

6. Protein automated matches [226850] (21 species)
   not a true protein

7. Species Francisella tularensis [TaxId:119856] [226001] (1 PDB entry)

8. Domain d3p7mc2: 3p7m C:146-318 [214687]
   Other proteins in same PDB: d3p7ma1, d3p7mb1, d3p7mc1, d3p7md1
   automated match to d1t2da2
   complexed with po4

Details for d3p7mc2

PDB Entry: 3p7m, 2.2 Å

PDB Description: structure of putative lactate dehydrogenase from francisella tularensis subsp. tularensis schu s4

PDB Compounds: (C:) malate dehydrogenase

SCOPe Domain Sequences for d3p7mc2:

Sequence; same for both SEQRES and ATOM records:

>d3p7mc2 d.162.1.0 (C:146-318) automated matches {Francisella tularensis [TaxId: 119856]}
gvldsarfrtfladelnvsvqqvqayvmgghgdtmvpltkmsnvagvsleqlvkegklkq
erldaivsrtrsgggeivallktgsayyapaaagiqmaesflkdkkmilpcaakvkagmy
gldedlfvgvpteisangvrpieveisdkereqlqvsinaikdlnkaaaeila

Timeline for d3p7mc2:

• d3p7mc2 is new in SCOPe 2.03-stable
  
• d3p7mc2 appears in SCOPe 2.04
  
• d3p7mc2 appears in the current release, SCOPe 2.08