Lineage for d3p7mc1 (3p7m C:1-145)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1346342Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1346343Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1349962Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 1349963Protein automated matches [190069] (159 species)
    not a true protein
  7. 1350479Species Francisella tularensis [TaxId:119856] [226000] (1 PDB entry)
  8. 1350482Domain d3p7mc1: 3p7m C:1-145 [214686]
    Other proteins in same PDB: d3p7ma2, d3p7mb2, d3p7mc2, d3p7md2
    automated match to d1t2da1
    complexed with po4

Details for d3p7mc1

PDB Entry: 3p7m (more details), 2.2 Å

PDB Description: structure of putative lactate dehydrogenase from francisella tularensis subsp. tularensis schu s4
PDB Compounds: (C:) malate dehydrogenase

SCOPe Domain Sequences for d3p7mc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3p7mc1 c.2.1.0 (C:1-145) automated matches {Francisella tularensis [TaxId: 119856]}
markkitlvgagniggtlahlalikqlgdvvlfdiaqgmpngkaldllqtcpiegvdfkv
rgtndykdlensdvvivtagvprkpgmsrddllginikvmqtvgegikhncpnafvicit
npldimvnmlqkfsgvpdnkivgma

SCOPe Domain Coordinates for d3p7mc1:

Click to download the PDB-style file with coordinates for d3p7mc1.
(The format of our PDB-style files is described here.)

Timeline for d3p7mc1: