Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily) unusual fold, defines family |
Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) |
Family d.162.1.0: automated matches [227146] (1 protein) not a true family |
Protein automated matches [226850] (47 species) not a true protein |
Species Francisella tularensis [TaxId:119856] [226001] (1 PDB entry) |
Domain d3p7mb2: 3p7m B:146-318 [214685] Other proteins in same PDB: d3p7ma1, d3p7mb1, d3p7mb3, d3p7mc1, d3p7md1, d3p7md3 automated match to d1t2da2 complexed with po4 |
PDB Entry: 3p7m (more details), 2.2 Å
SCOPe Domain Sequences for d3p7mb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3p7mb2 d.162.1.0 (B:146-318) automated matches {Francisella tularensis [TaxId: 119856]} gvldsarfrtfladelnvsvqqvqayvmgghgdtmvpltkmsnvagvsleqlvkegklkq erldaivsrtrsgggeivallktgsayyapaaagiqmaesflkdkkmilpcaakvkagmy gldedlfvgvpteisangvrpieveisdkereqlqvsinaikdlnkaaaeila
Timeline for d3p7mb2: