Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
Protein automated matches [190069] (203 species) not a true protein |
Species Francisella tularensis [TaxId:119856] [226000] (1 PDB entry) |
Domain d3p7mb1: 3p7m B:0-145 [214684] Other proteins in same PDB: d3p7ma2, d3p7mb2, d3p7mc2, d3p7md2 automated match to d1t2da1 complexed with po4 |
PDB Entry: 3p7m (more details), 2.2 Å
SCOPe Domain Sequences for d3p7mb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3p7mb1 c.2.1.0 (B:0-145) automated matches {Francisella tularensis [TaxId: 119856]} amarkkitlvgagniggtlahlalikqlgdvvlfdiaqgmpngkaldllqtcpiegvdfk vrgtndykdlensdvvivtagvprkpgmsrddllginikvmqtvgegikhncpnafvici tnpldimvnmlqkfsgvpdnkivgma
Timeline for d3p7mb1: