Lineage for d3p7ma2 (3p7m A:146-318)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2232528Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 2232529Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) (S)
  5. 2233134Family d.162.1.0: automated matches [227146] (1 protein)
    not a true family
  6. 2233135Protein automated matches [226850] (29 species)
    not a true protein
  7. 2233233Species Francisella tularensis [TaxId:119856] [226001] (1 PDB entry)
  8. 2233234Domain d3p7ma2: 3p7m A:146-318 [214683]
    Other proteins in same PDB: d3p7ma1, d3p7mb1, d3p7mb3, d3p7mc1, d3p7md1, d3p7md3
    automated match to d1t2da2
    complexed with po4

Details for d3p7ma2

PDB Entry: 3p7m (more details), 2.2 Å

PDB Description: structure of putative lactate dehydrogenase from francisella tularensis subsp. tularensis schu s4
PDB Compounds: (A:) malate dehydrogenase

SCOPe Domain Sequences for d3p7ma2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3p7ma2 d.162.1.0 (A:146-318) automated matches {Francisella tularensis [TaxId: 119856]}
gvldsarfrtfladelnvsvqqvqayvmgghgdtmvpltkmsnvagvsleqlvkegklkq
erldaivsrtrsgggeivallktgsayyapaaagiqmaesflkdkkmilpcaakvkagmy
gldedlfvgvpteisangvrpieveisdkereqlqvsinaikdlnkaaaeila

SCOPe Domain Coordinates for d3p7ma2:

Click to download the PDB-style file with coordinates for d3p7ma2.
(The format of our PDB-style files is described here.)

Timeline for d3p7ma2: