Lineage for d3p7hc1 (3p7h C:198-325)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1442549Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 1442550Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 1443240Family d.169.1.0: automated matches [191331] (1 protein)
    not a true family
  6. 1443241Protein automated matches [190159] (8 species)
    not a true protein
  7. 1443271Species Human (Homo sapiens) [TaxId:9606] [186882] (56 PDB entries)
  8. 1443402Domain d3p7hc1: 3p7h C:198-325 [214680]
    automated match to d2ziba_
    complexed with ca, mal

Details for d3p7hc1

PDB Entry: 3p7h (more details), 2.3 Å

PDB Description: structure of the human langerin carbohydrate recognition domain in complex with maltose
PDB Compounds: (C:) C-type lectin domain family 4 member K

SCOPe Domain Sequences for d3p7hc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3p7hc1 d.169.1.0 (C:198-325) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gwkyfkgnfyyfslipktwysaeqfcvsrnshltsvtseseqeflyktaggliywigltk
agmegdwswvddtpfnkvqsvrfwipgepnnagnnehcgnikapslqawndapcdktflf
ickrpyvp

SCOPe Domain Coordinates for d3p7hc1:

Click to download the PDB-style file with coordinates for d3p7hc1.
(The format of our PDB-style files is described here.)

Timeline for d3p7hc1: